Recombinant HCC‑4/CCL16, Human (CHO-expressed) - BK0219

Recombinant HCC‑4/CCL16, Human (CHO-expre Ssed) Catalogue Numbers: BK0219-10, BK0219-50 Sizes: 10μg, 50μg Source: CHO Molecular Weight: 12 kDa, observed by reducing SDS-PAGE. Purity: > 98% as analyzed by SDS-PAGE. Biological Activity: The EC50 value of human HCC‑4/CCL16 on Caˆ2+ mobilization assay in CHO-K1/Ga15/hCCR1 cells (human Ga15 and human CCR1 stably expressed in CHO-K1 cells) is less than 1.5 μg/ml. Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Formulation: Lyophilized after extensive dialysis against PBS. AA Sequence: QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLST VKIITAKNGQPQLLNSQ Endotoxin: < 0.2 EU/μg, determined by LAL method. Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml. Storage: Lyophilized recombinant human HCC‑4/CCL16 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human HCC‑4/CCL16 should be stable up to 1 week at 4°C or up to 2 months