Recombinant Human MCP-2 （rHu MCP-2/CCL8） - PR1087

Recombinant Human MCP-2 （rHu MCP-2/CCL8） Catalogue Numbers: PR1087-2, PR1087-10 Sizes: 2µg, 10µg Source: Escherichia coli Molecular Weight: 8.9 kDa, a single non-glycosylated polypeptide chain containing 76 amino acids. Purity: >96% by SDS-PAGE and HPLC analyses. Biological Activity: Fully biologically active when compared to standard. Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells.The ED50 for this effect is typically 0.03-0.1μg/mL, corresponding to a Specific Activity of ＞1 x 104 IU/mg. Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Formulation: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl. AA Sequence: QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP Endotoxin: Less than 1EU/mg of rHuMCP-2/CCL8 as determined by LAL method. Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the