Recombinant Human MIP-4 (rHuMIP-4/CCL18) - PR1098

Recombinant Human MIP-4 (rHuMIP-4/CCL18) Catalogue Numbers: PR1098-2, PR1098-10 Sizes: 2µg, 10µg Source: Escherichia coli Molecular Weight: 7.8 kDa, a single non-glycosylated polypeptide chain containing 69 amino acids. Purity: >97% by SDS-PAGE and HPLC analyses. Biological Activity: Fully biologically active when compared to standard. Determined by its ability to chemoattract human T lymphocytes using a concentration range of 1.0 -10.0 ng/ml, corresponding to a Specific Activity of ＞1 x 105 IU/mg. Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Formulation: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl. AA Sequence: AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA Endotoxin: Less than 1EU/mg of rHuMIP-4/CCL18 as determined by LAL method. Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile