Recombinant IL-6, Human (CHO-expressed) - BK0253

Recombinant IL-6, Human (CHO-expre Ssed) Catalogue Numbers: BK0253-10, BK0253-50 Sizes: 10μg, 50μg Source: CHO Molecular Weight: 21-23 kDa, observed by reducing SDS-PAGE. Purity: > 95% as analyzed by SDS-PAGE. Biological Activity: ED50 < 0.06 ng/ml, measured in a cell proliferation assay using 7TD1 cells. Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Formulation: Lyophilized after extensive dialysis against PBS. AA Sequence: PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNE ETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQD MTTHLILRSFKEFLQSSLRALRQM Endotoxin: < 0.2 EU/μg, determined by LAL method. Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml. Storage: Lyophilized recombinant Human Interleukin-6 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-6 should be stable up to 1 week at 4°C or up to 2 months at -20°C