Recombinant MIP-1β/CCL4, Human - BK0271

Recombinant MIP-1β/CCL4, Human - BK0271

$155.29
{{option.name}}: {{selected_options[option.position]}}
{{value_obj.value}}

Recombinant MIP-1β/CCL4, Human Catalogue Numbers: BK0271-5, BK0271-25 Sizes: 5μg, 25μg Source: CHO Molecular Weight: 10-19 kDa, observed by reducing SDS-PAGE. Purity: > 95% as analyzed by SDS-PAGE and HPLC. Biological Activity: The EC50 value of human MIP-1 beta /CCL4 on Caˆ2+ mobilization assay in CHO-K1/ Gα15/hCCR5 cells (human Gα15 and human CCR5 stably expressed in CHO-K1 cells) is less than 150 ng/ml. Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Formulation: Lyophilized after extensive dialysis against PBS. AA Sequence: APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQ EYVYDLELN Endotoxin: < 0.2 EU/μg, determined by LAL method. Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml. Storage: Lyophilized recombinant Human MIP-1β/CCL4 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human MIP-1β/CCL4 should be stable up to 1 week at 4°C or up to 3 months at -20°C. Usage: This materi

Show More Show Less

Price History

$132 $155.29 (+$23.29)