Recombinant VEGF-D, Human - BK0294

Recombinant VEGF-D, Human - BK0294

$268.24
{{option.name}}: {{selected_options[option.position]}}
{{value_obj.value}}

Recombinant VEGF-D, Human Catalogue Numbers: BK0294-10, BK0294-50 Sizes: 10μg, 50μg Source: CHO Molecular Weight: 18-19 kDa, observed by reducing SDS-PAGE. Purity: > 95% as analyzed by SDS-PAGE and HPLC. Biological Activity: ED50 < 1 μg /ml, measured in a cell proliferation assay using HUVEC cells. Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Formulation: Lyophilized after extensive dialysis against PBS. AA Sequence: FAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEI SVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSIIRR Endotoxin: < 0.2 EU/μg, determined by LAL method. Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml. Storage: Lyophilized recombinant Human VEGF-D remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human VEGF-D should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage: This material is offered by USA Bioworld biotech for research, laboratory or fur

Show More Show Less

Price History

$228 $268.24 (+$40.24)