
Recombinant VEGF165, Human (HEK293-expre Ssed) - BK0335
Recombinant VEGF165, Human (HEK293-expre Ssed) Catalogue Numbers: BK0335-10, BK0335-50 Sizes: 10μg, 50μg Source: HEK 293 Molecular Weight: 20~26 kDa, observed by reducing SDS-PAGE. Purity: > 95% as analyzed by SDS-PAGE. Biological Activity: ED50 <16 ng/ml, measured in a cell proliferation assay using HUVEC cells. Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Formulation: Lyophilized after extensive dialysis against PBS. AA Sequence: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQI MRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRC DKPRR Endotoxin: < 0.2 EU/μg, determined by LAL method. Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml. Storage: Lyophilized recombinant Human Vascular Endothelial Growth Factor 165 (VEGF-165) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Vascular Endothelial Growth Factor 165 (VEGF-165) sh