Recombinant Human B-Lymphocyte Antigen Cd20 (MS4A1) Protein (GST)

Recombinant Human B-Lymphocyte Antigen Cd20 (MS4A1) Protein (GST)

$418.40
{{option.name}}: {{selected_options[option.position]}}
{{value_obj.value}}

Product Overview Description Recombinant Human B-Lymphocyte Antigen Cd20 (MS4A1) Protein (GST) is produced by our E.coli expression system. This is a protein fragment. Purity Greater than 85% as determined by SDS-PAGE. Uniprotkb P11836 Target Symbol MS4A1 Species Homo sapiens (Human) Expression System E.coli Tag N-GST Target Protein Sequence IAGIVENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP Expression Range 209-297aa Protein Length Partial Mol. Weight 36.9 kDa Research Area Cancer Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommen

Show More Show Less