Recombinant Sars-Cov-2 Nucleoprotein (N) Protein (His), Active

Recombinant Sars-Cov-2 Nucleoprotein (N) Protein (His), Active

$424.80
{{option.name}}: {{selected_options[option.position]}}
{{value_obj.value}}

Product Overview Description Recombinant Sars-Cov-2 Nucleoprotein (N) Protein (His), Active is produced by our E.coli expression system. This is a full length protein. Purity Greater than 85% as determined by SDS-PAGE. Endotoxin Less than 1.0 EU/ug as determined by LAL method. Activity 1. Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-N at 2 μg/ml can bind SARS-CoV-2-N Antibody , the EC 50 of SARS-CoV-2-N protein is 1.368 -1.804 ng/ml. 2. Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-N at 2 μg/ml can bind SARS-CoV-2-N Antibody , the EC 50 of SARS-CoV-2-N protein is 4.267-5.568 ng/ml. Uniprotkb P0DTC9 Target Symbol N Synonyms N; Nucleoprotein; N; Nucleocapsid protein; NC; Protein N Species Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) Expression System E.coli Tag N-6His Target Protein Sequence MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDL

Show More Show Less