Recombinant G-CSF, Human (CHO-expressed) - BK0206

Recombinant G-CSF, Human (CHO-expressed) - BK0206

$183.53
{{option.name}}: {{selected_options[option.position]}}
{{value_obj.value}}

Recombinant G-CSF, Human (CHO-expre Ssed) Catalogue Numbers: BK0206-10, BK0206-50 Sizes: 10μg, 50μg Source: CHO Molecular Weight: 18.7kDa, observed by non-reducing SDS-PAGE. Purity: > 95% as analyzed by SDS-PAGE and HPLC. Biological Activity: ED50< 0.1 ng/ml, determined by the dose-dependent stimulation of the proliferation of murine M-NFS-60 cells, corresponding to a specific activity of >1 x 10ˆ7 units/mg. Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Formulation: Lyophilized after extensive dialysis against PBS. AA Sequence: TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHS GLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSF LEVSYRVLRHLAQP Endotoxin: <0.2 EU/μg, determined by LAL method. Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml. Storage: Lyophilized recombinant human Granulocyte Colony Stimulating Factor (G-CSF) remains stable up to 6 months at -80

Show More Show Less

Price History

$156 $183.53 (+$27.53)