Recombinant G-CSF, Mouse - BK0207

Recombinant G-CSF, Mouse Catalogue Numbers: BK0207-10, BK0207-50 Sizes: 10μg, 50μg Source: CHO Molecular Weight: 22-24 kDa, observed by reducing SDS-PAGE. Purity: > 95% as analyzed by SDS-PAGE and HPLC. Biological Activity: ED50 <0.02ng/ml, measured in a cell proliferation assay using NFS-60 cells. Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Formulation: Lyophilized after extensive dialysis against PBS. AA Sequence: VPLVt VSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQC LSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPt VQPTQSAMPAFTSAFQRRAGGVLAI SYLQGFLETARLALHHLA Endotoxin: < 0.2 EU/μg, determined by LAL method. Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml. Storage: Lyophilized recombinant murine G-CSF remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, murine G-CSF should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage: This material i