
Recombinant GRO-α/KC/CXCL1, Mouse (CHO-expressed) - BK0216
Recombinant GRO-α/KC/CXCL1, Mouse (CHO-expre Ssed) Catalogue Numbers: BK0216-5, BK0216-25 Sizes: 5μg, 25μg Source: CHO Molecular Weight: 5-7 kDa, observed by reducing SDS-PAGE. Purity: > 95% as analyzed by SDS-PAGE and HPLC. Biological Activity: Active at 10 ng/ml, measured in a tube formation assay using HUVEC cells. Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Formulation: Lyophilized after extensive dialysis against PBS. AA Sequence: APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK Endotoxin: < 0.2 EU/μg, determined by LAL method. Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml. Storage: Lyophilized recombinant Mouse GRO remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Mouse GRO should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For resear