Recombinant IL-1β, Mouse (CHO-expressed) - BK0239

Recombinant IL-1β, Mouse (CHO-expressed) - BK0239

$183.53
{{option.name}}: {{selected_options[option.position]}}
{{value_obj.value}}

Recombinant IL-1β, Mouse (CHO-expre Ssed) Catalogue Numbers: BK0239-10, BK0239-50 Sizes: 10μg, 50μg Source: CHO Molecular Weight: 17.4 kDa, observed by non-reducing SDS-PAGE. Purity: > 95% as analyzed by SDS-PAGE and HPLC. Biological Activity: ED50 < 10 pg/ml, measured in a cell proliferation assay using D10S cells, corresponding to a specific activity of > 1×10ˆ8 units/mg. Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Formulation: Lyophilized after extensive dialysis against PBS. AA Sequence: VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTL QLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS Endotoxin: <0.2 EU/μg, determined by LAL method. Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml. Storage: Lyophilized recombinant Murine Interleukin 1 beta (IL-1 beta) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rmIL-1beta should be stable

Show More Show Less

Price History

$156 $183.53 (+$27.53)