Recombinant IL-8/CXCL8 (8-79aa), Human (CHO-expressed) - BK0258

Recombinant IL-8/CXCL8 (8-79aa), Human (CHO-expre Ssed) Catalogue Numbers: BK0258-10, BK0258-50 Sizes: 10μg, 50μg Source: CHO Molecular Weight: ~9 kDa, observed by reducing SDS-PAGE Purity: > 95% as analyzed by SDS-PAGE and HPLC. Biological Activity: ED50 < 6 ng/ml, measured in a calcium flux assay using CHO/Gα15 cells transiently expressing CXCR1. Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Formulation: Lyophilized after extensive dialysis against PBS. AA Sequence: AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS Endotoxin: < 0.2 EU/μg, determined by LAL method. Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml. Storage: Lyophilized recombinant Human Interleukin-8 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-8 should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage: This material is offered by USA Bioworld biotech for rese