Recombinant Dog Growth/Differentiation Factor 8 (MSTN) Protein (His&Myc)

Product Overview Description Recombinant Dog Growth/Differentiation Factor 8 (MSTN) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. Purity Greater than 85% as determined by SDS-PAGE. Uniprotkb Q6UKZ8 Target Symbol MSTN Species Canis lupus familiaris (Dog) (Canis familiaris) Expression System E.coli Tag N-10His&C-Myc Target Protein Sequence DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS Expression Range 267-375aa Protein Length Full Length of Mature Protein Mol. Weight 19.9 kDa Research Area Cancer Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Recons