Recombinant Horse Growth/Differentiation Factor 8 (MSTN) Protein (His)

Recombinant Horse Growth/Differentiation Factor 8 (MSTN) Protein (His)

$680.80
{{option.name}}: {{selected_options[option.position]}}
{{value_obj.value}}

Product Overview Description Recombinant Horse Growth/Differentiation Factor 8 (MSTN) Protein (His) is produced by our E.coli expression system. This is a full length protein. Purity Greater than 90% as determined by SDS-PAGE. Uniprotkb Q9GM97 Target Symbol MSTN Species Equus caballus (Horse) Expression System E.coli Tag N-6His Target Protein Sequence DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS Expression Range 267-375aa Protein Length Full Length of Mature Protein Mol. Weight 18.4 kDa Research Area Cancer Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water

Show More Show Less