Recombinant Human Cd81 Antigen (CD81) Protein (hFc)

Product Overview Description Recombinant Human Cd81 Antigen (CD81) Protein (hFc) is produced by our Mammalian cell expression system. This is a protein fragment. Purity Greater than 85% as determined by SDS-PAGE. Uniprotkb P60033 Target Symbol CD81 Synonyms 26 kDa cell surface protein TAPA 1; 26 kDa cell surface protein TAPA-1; 26 kDa cell surface protein TAPA1; CD 81; CD81; CD81 antigen (target of antiproliferative 1); CD81 antigen; CD81 molecule; CD81_HUMAN; CVID6; S5.7; TAPA 1; TAPA1; Target of the antiproliferative 1; Tetraspanin 28; Tetraspanin-28; Tetraspanin28; Tspan 28; Tspan-28; Tspan28 Species Homo sapiens (Human) Expression System Mammalian cell Tag C-hFc Target Protein Sequence FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK Expression Range 113-201aa Protein Length Partial Mol. Weight 38.7 Research Area Immunology Form Liquid or Lyophilized powder Buffer Liquid form: default storage