Recombinant Mouse Cd81 Antigen (CD81) Protein (GST)

Product Overview Description Recombinant Mouse Cd81 Antigen (CD81) Protein (GST) is produced by our E.coli expression system. This is a extracellular protein. Purity Greater than 90% as determined by SDS-PAGE. Uniprotkb P35762 Target Symbol CD81 Synonyms Cd81; Tapa1CD81 antigen; 26 kDa cell surface protein TAPA-1; Target of the antiproliferative antibody 1; CD antigen CD81 Species Mus musculus (Mouse) Expression System E.coli Tag N-GST Target Protein Sequence KDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNALTTLTTTILRNSLCPSGGNILTPLLQQDCHQKIDELFSGK Expression Range 116-201aa Protein Length Extracellular Domain Mol. Weight 36.4kDa Research Area Others Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly centrifuged the vial prior to opening to bri