Recombinant Mouse Cd63 Antigen (CD63) Protein (GST)

Product Overview Description Recombinant Mouse Cd63 Antigen (CD63) Protein (GST) is produced by our E.coli expression system. This is a extracellular protein. Purity Greater than 90% as determined by SDS-PAGE. Uniprotkb P41731 Target Symbol CD63 Synonyms Cd63CD63 antigen; CD antigen CD63 Species Mus musculus (Mouse) Expression System E.coli Tag N-GST Target Protein Sequence AGYVFRDQVKSEFNKSFQQQMQNYLKDNKTATILDKLQKENNCCGASNYTDWENIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGCVETIAIWLRKNI Expression Range 103-203aa Protein Length Extracellular Domain Mol. Weight 38.5kDa Research Area Others Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile