Recombinant Noggin, Human (CHO-expressed) - BK0277

Recombinant Noggin, Human (CHO-expressed) - BK0277

$155.29
{{option.name}}: {{selected_options[option.position]}}
{{value_obj.value}}

Recombinant Noggin, Human (CHO-expre Ssed) Catalogue Numbers: BK0277-10, BK0277-50 Sizes: 10μg, 50μg Source: CHO Molecular Weight: 29-31kDa, observed by reducing SDS-PAGE. Purity: > 95% as analyzed by SDS-PAGE. Biological Activity: ED50<2.5 ng/ml, measured in a bioassay using ATDC5 cells in the presence of 10ng/ml human BMP-4. Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Formulation: Lyophilized after extensive dialysis against PBS. AA Sequence: QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDR PGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQM WLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLt VLRWRC QRRGGQRCGWIPIQYPIISECKCSC Endotoxin: <0.2 EU/μg, determined by LAL method. Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml. Storage: Lyophilized recombinant human Noggin remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human Nogginshould be stable up to 1 week at

Show More Show Less

Price History

$132 $155.29 (+$23.29)